ART5 Antikörper (Middle Region)
-
- Target Alle ART5 Antikörper anzeigen
- ART5 (ADP-Ribosyltransferase 5 (ART5))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ART5 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ART5 antibody was raised against the middle region of ART5
- Aufreinigung
- Affinity purified
- Immunogen
- ART5 antibody was raised using the middle region of ART5 corresponding to a region with amino acids VFPKEREVLIPPHEVFLVTRFSQDGAQSLVTLWSYNQTCSHFNCAYLGGE
- Top Product
- Discover our top product ART5 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ART5 Blocking Peptide, catalog no. 33R-9536, is also available for use as a blocking control in assays to test for specificity of this ART5 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ART5 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ART5 (ADP-Ribosyltransferase 5 (ART5))
- Andere Bezeichnung
- ART5 (ART5 Produkte)
- Synonyme
- ARTC5 antikoerper, Yac-2 antikoerper, ART5 antikoerper, Art5 antikoerper, art5 antikoerper, ADP-ribosyltransferase 5 antikoerper, ecto-ADP-ribosyltransferase 5-like antikoerper, ecto-ADP-ribosyltransferase 5 antikoerper, ADP-ribosyltransferase 5 L homeolog antikoerper, ART5 antikoerper, Art5 antikoerper, LOC618664 antikoerper, LOC100715378 antikoerper, art5.L antikoerper
- Hintergrund
- The protein encoded by this gene belongs to the ARG-specific ADP-ribosyltransferase family. Proteins in this family regulate the function of target proteins by attaching ADP-ribose to specific amino acid residues in their target proteins. The mouse homolog lacks a glycosylphosphatidylinositol-anchor signal sequence and is predicted to be a secretory enzyme. Transcript variants with different 5' UTRs, but encoding the same protein have been found for this gene.
- Molekulargewicht
- 30 kDa (MW of target protein)
-