SMPDL3B Antikörper (N-Term)
-
- Target Alle SMPDL3B Antikörper anzeigen
- SMPDL3B (Sphingomyelin phosphodiesterase, Acid-Like 3B (SMPDL3B))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SMPDL3B Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- SMPDL3 B antibody was raised against the N terminal of SMPDL3
- Aufreinigung
- Affinity purified
- Immunogen
- SMPDL3 B antibody was raised using the N terminal of SMPDL3 corresponding to a region with amino acids ILWTGDDTPHVPDEKLGEAAVLEIVERLTKLIREVFPDTKVYAALGNHDF
- Top Product
- Discover our top product SMPDL3B Primärantikörper
-
anti-Sphingomyelin phosphodiesterase, Acid-Like 3B (SMPDL3B) (AA 274-372) antibody
SMPDL3B Reaktivität: Human WB, ELISA Wirt: Maus Monoclonal 5E12 unconjugated
anti-Sphingomyelin phosphodiesterase, Acid-Like 3B (SMPDL3B) (AA 1-373) antibodySMPDL3B Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
anti-Sphingomyelin phosphodiesterase, Acid-Like 3B (SMPDL3B) (AA 88-137) antibodySMPDL3B Reaktivität: Human, Maus, Ratte, Rind (Kuh), Hund, Meerschweinchen, Schwein WB, IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Sphingomyelin phosphodiesterase, Acid-Like 3B (SMPDL3B) (N-Term) antibodySMPDL3B Reaktivität: Human, Maus, Ratte, Rind (Kuh), Hund, Meerschweinchen, Pferd, Kaninchen, Zebrafisch (Danio rerio) WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Sphingomyelin phosphodiesterase, Acid-Like 3B (SMPDL3B) (AA 1-373) antibodySMPDL3B Reaktivität: Human WB Wirt: Maus Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SMPDL3B Blocking Peptide, catalog no. 33R-4064, is also available for use as a blocking control in assays to test for specificity of this SMPDL3B antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SMPDL0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SMPDL3B (Sphingomyelin phosphodiesterase, Acid-Like 3B (SMPDL3B))
- Andere Bezeichnung
- SMPDL3B (SMPDL3B Produkte)
- Synonyme
- ASML3B antikoerper, 1110054A24Rik antikoerper, AU045240 antikoerper, Asml3b antikoerper, im:7137990 antikoerper, si:ch1073-55d10.1 antikoerper, sphingomyelin phosphodiesterase acid like 3B antikoerper, sphingomyelin phosphodiesterase, acid-like 3B antikoerper, SMPDL3B antikoerper, Smpdl3b antikoerper, smpdl3b antikoerper
- Hintergrund
- Located on chromosome 1, this gene encodes for acid sphingomyelinase-like phosphodiesterase 3b precursor protein.
- Molekulargewicht
- 52 kDa (MW of target protein)
-
