WFDC5 Antikörper (N-Term)

Produktnummer ABIN633949

Produktdetails anti-WFDC5 Antikörper

Target: WFDC5 (WAP Four-Disulfide Core Domain 5 (WFDC5))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser WFDC5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: WFDC5 antibody was raised against the N terminal of WFDC5

Aufreinigung: Affinity purified

Immunogen: WFDC5 antibody was raised using the N terminal of WFDC5 corresponding to a region with amino acids MRTQSLLLLGALLAVGSQLPAVFGRKKGEKSGGCPPDDGPCLLSVPDQCV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

WFDC5 Blocking Peptide, catalog no. 33R-6386, is also available for use as a blocking control in assays to test for specificity of this WFDC5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WFDC5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu WFDC5

Target: WFDC5 (WAP Four-Disulfide Core Domain 5 (WFDC5))

Andere Bezeichnung: WFDC5 (WFDC5 Produkte)

Synonyme: Prg5 antikoerper, Wap1 antikoerper, BC019734 antikoerper, PRG5 antikoerper, WAP1 antikoerper, dJ211D12.5 antikoerper, WAP four-disulfide core domain 5 antikoerper, Wfdc5 antikoerper, WFDC5 antikoerper

Hintergrund: This gene encodes a member of the WAP-type four-disulfide core (WFDC) domain family. Most WFDC proteins contain only one WFDC domain, and this encoded protein contains two WFDC domains. The WFDC domain, or WAP signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor. Most WFDC gene members are localized to chromosome 20q12-q13 in two clusters: centromeric and telomeric. This gene belongs to the centromeric cluster.

Molekulargewicht: 11 kDa (MW of target protein)