WFDC5 Antikörper (N-Term)
-
- Target Alle WFDC5 Antikörper anzeigen
- WFDC5 (WAP Four-Disulfide Core Domain 5 (WFDC5))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser WFDC5 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- WFDC5 antibody was raised against the N terminal of WFDC5
- Aufreinigung
- Affinity purified
- Immunogen
- WFDC5 antibody was raised using the N terminal of WFDC5 corresponding to a region with amino acids MRTQSLLLLGALLAVGSQLPAVFGRKKGEKSGGCPPDDGPCLLSVPDQCV
- Top Product
- Discover our top product WFDC5 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
WFDC5 Blocking Peptide, catalog no. 33R-6386, is also available for use as a blocking control in assays to test for specificity of this WFDC5 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WFDC5 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- WFDC5 (WAP Four-Disulfide Core Domain 5 (WFDC5))
- Andere Bezeichnung
- WFDC5 (WFDC5 Produkte)
- Hintergrund
- This gene encodes a member of the WAP-type four-disulfide core (WFDC) domain family. Most WFDC proteins contain only one WFDC domain, and this encoded protein contains two WFDC domains. The WFDC domain, or WAP signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor. Most WFDC gene members are localized to chromosome 20q12-q13 in two clusters: centromeric and telomeric. This gene belongs to the centromeric cluster.
- Molekulargewicht
- 11 kDa (MW of target protein)
-