FUT6 Antikörper (C-Term)

Produktnummer ABIN633952

Produktdetails anti-FUT6 Antikörper

Target: FUT6 (Fucosyltransferase 6 (Alpha (1,3) Fucosyltransferase) (FUT6))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FUT6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: FUT6 antibody was raised against the C terminal of FUT6

Aufreinigung: Affinity purified

Immunogen: FUT6 antibody was raised using the C terminal of FUT6 corresponding to a region with amino acids YITEKLWRNALEAWAVPVVLGPSRSNYERFLPPDAFIHVDDFQSPKDLAR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FUT6 Blocking Peptide, catalog no. 33R-10142, is also available for use as a blocking control in assays to test for specificity of this FUT6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FUT6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FUT6

Target: FUT6 (Fucosyltransferase 6 (Alpha (1,3) Fucosyltransferase) (FUT6))

Andere Bezeichnung: FUT6 (FUT6 Produkte)

Synonyme: FCT3A antikoerper, FT1A antikoerper, Fuc-TVI antikoerper, FucT-VI antikoerper, FUT3 antikoerper, fut antikoerper, FUT antikoerper, FUTB antikoerper, ATFUT6 antikoerper, F7A19.16 antikoerper, F7A19_16 antikoerper, fucosyltransferase 6 antikoerper, fut6 antikoerper, fucosyltransferase 6 antikoerper, fucosyltransferase 6 S homeolog antikoerper, FUT6 antikoerper, fut6.S antikoerper

Hintergrund: FUT6 is a Golgi stack membrane protein that is involved in the creation of sialyl-Lewis X, an E-selectin ligand. Mutations in this gene are a cause of fucosyltransferase-6 deficiency. The protein encoded by this gene is a Golgi stack membrane protein that is involved in the creation of sialyl-Lewis X, an E-selectin ligand. Mutations in this gene are a cause of fucosyltransferase-6 deficiency. Two transcript variants encoding the same protein have been found for this gene.

Molekulargewicht: 42 kDa (MW of target protein)