LOXL1 Antikörper (Middle Region)
-
- Target Alle LOXL1 Antikörper anzeigen
- LOXL1 (Lysyl Oxidase-Like 1 (LOXL1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser LOXL1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- LOXL1 antibody was raised against the middle region of LOXL1
- Aufreinigung
- Affinity purified
- Immunogen
- LOXL1 antibody was raised using the middle region of LOXL1 corresponding to a region with amino acids YRPNQNGRGLPDLVPDPNYVQASTYVQRAHLYSLRCAAEEKCLASTAYAP
- Top Product
- Discover our top product LOXL1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
LOXL1 Blocking Peptide, catalog no. 33R-10229, is also available for use as a blocking control in assays to test for specificity of this LOXL1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LOXL1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LOXL1 (Lysyl Oxidase-Like 1 (LOXL1))
- Andere Bezeichnung
- LOXL1 (LOXL1 Produkte)
- Synonyme
- LOL antikoerper, LOXL antikoerper, Loxl antikoerper, si:ch211-238c15.1 antikoerper, lol antikoerper, loxl antikoerper, loxl-1 antikoerper, oxl-1 antikoerper, lysyl oxidase like 1 antikoerper, lysyl oxidase-like 1 antikoerper, lysyl oxidase like 1 L homeolog antikoerper, LOXL1 antikoerper, loxl1 antikoerper, Loxl1 antikoerper, loxl1.L antikoerper
- Hintergrund
- LOXL1 is a member of the lysyl oxidase family. The prototypic member of the family is essential to the biogenesis of connective tissue, encoding an extracellular copper-dependent amine oxidase that catalyses the first step in the formation of crosslinks in collagens and elastin. A highly conserved amino acid sequence at the C-terminus end appears to be sufficient for amine oxidase activity, suggesting that each family member may retain this function.
- Molekulargewicht
- 53 kDa (MW of target protein)
-