Plexin A4 Antikörper (Middle Region)
-
- Target Alle Plexin A4 (PLXNA4) Antikörper anzeigen
- Plexin A4 (PLXNA4)
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Plexin A4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Plexin A4 antibody was raised against the middle region of PLXNA4
- Aufreinigung
- Affinity purified
- Immunogen
- Plexin A4 antibody was raised using the middle region of PLXNA4 corresponding to a region with amino acids TQEWIGVEGDPPGANIASQEQMLCVYLQCSSHKAISDQRVQPLLCCFLNV
- Top Product
- Discover our top product PLXNA4 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Plexin A4 Blocking Peptide, catalog no. 33R-9241, is also available for use as a blocking control in assays to test for specificity of this Plexin A4 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLXNA4 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Plexin A4 (PLXNA4)
- Andere Bezeichnung
- Plexin A4 (PLXNA4 Produkte)
- Synonyme
- D204 antikoerper, wu:fd49b01 antikoerper, wu:fe15f03 antikoerper, PLXNA4A antikoerper, FAYV2820 antikoerper, PLEXA4 antikoerper, PLXNA4B antikoerper, PRO34003 antikoerper, 9330117B14 antikoerper, Plxa4 antikoerper, mKIAA1550 antikoerper, PLEX2 antikoerper, Plxna4 antikoerper, PLXNA4 antikoerper, plexin A4 antikoerper, plexin-A4 antikoerper, plxna4 antikoerper, PLXNA4 antikoerper, LOC100467706 antikoerper, Plxna4 antikoerper
- Hintergrund
- This protein mediates semaphorin receptor activity.
- Molekulargewicht
- 57 kDa (MW of target protein)
- Pathways
- Regulation of Cell Size
-