Calreticulin 3 Antikörper (N-Term)
-
- Target Alle Calreticulin 3 (CALR3) Antikörper anzeigen
- Calreticulin 3 (CALR3)
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Calreticulin 3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Calreticulin 3 antibody was raised against the N terminal of CALR3
- Aufreinigung
- Affinity purified
- Immunogen
- Calreticulin 3 antibody was raised using the N terminal of CALR3 corresponding to a region with amino acids MAGPQQQPPYLHLAELTASQFLEIWKHFDADGNGYIEGKELENFFQELEK
- Top Product
- Discover our top product CALR3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Calreticulin 3 Blocking Peptide, catalog no. 33R-5666, is also available for use as a blocking control in assays to test for specificity of this Calreticulin 3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CALR3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Calreticulin 3 (CALR3)
- Andere Bezeichnung
- Calreticulin 3 (CALR3 Produkte)
- Synonyme
- 1700031L01Rik antikoerper, 6330586I20Rik antikoerper, Crt2 antikoerper, cspn antikoerper, CMH19 antikoerper, CRT2 antikoerper, CT93 antikoerper, A. thaliana calreticulin 3 antikoerper, AtCRT3 antikoerper, CALRETICULIN 3 antikoerper, EBS2 antikoerper, EMS-MUTAGENIZED BRI1 SUPPRESSOR 2 antikoerper, PRIORITY IN SWEET LIFE 1 antikoerper, PSL1 antikoerper, T27G7.13 antikoerper, T27G7_13 antikoerper, calreticulin 3 antikoerper, CALR antikoerper, calreticulin 3 antikoerper, CALR3 antikoerper, Calr3 antikoerper, CRT3 antikoerper
- Hintergrund
- Calreticulins, such as CALR3, are Ca(2+)-binding chaperones localized mainly in the endoplasmic/sarcoplasmic reticulum.
- Molekulargewicht
- 42 kDa (MW of target protein)
- Pathways
- Activation of Innate immune Response
-