ANGPTL5 Antikörper (N-Term)
-
- Target Alle ANGPTL5 Antikörper anzeigen
- ANGPTL5 (Angiopoietin-Like 5 (ANGPTL5))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ANGPTL5 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ANGPTL5 antibody was raised against the N terminal of ANGPTL5
- Aufreinigung
- Affinity purified
- Immunogen
- ANGPTL5 antibody was raised using the N terminal of ANGPTL5 corresponding to a region with amino acids ASLDYLSNQVNELMNRVLLLTTEVFRKQLDPFPHRPVQSHGLDCTDIKDT
- Top Product
- Discover our top product ANGPTL5 Primärantikörper
-
anti-Angiopoietin-Like 5 (ANGPTL5) (AA 1-388) antibody
ANGPTL5 Reaktivität: Human WB, ELISA, IP Wirt: Maus Monoclonal 1B2 unconjugated
anti-Angiopoietin-Like 5 (ANGPTL5) (AA 141-383) antibodyANGPTL5 Reaktivität: Human WB, IHC, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Angiopoietin-Like 5 (ANGPTL5) (Coiled coil domain) antibodyANGPTL5 Reaktivität: Human WB, ELISA Wirt: Kaninchen Polyclonal unconjugated
anti-Angiopoietin-Like 5 (ANGPTL5) (AA 1-388) antibodyANGPTL5 Reaktivität: Human WB Wirt: Maus Polyclonal unconjugated
anti-Angiopoietin-Like 5 (ANGPTL5) (AA 1-388) antibodyANGPTL5 Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
anti-Angiopoietin-Like 5 (ANGPTL5) (AA 107-156) antibodyANGPTL5 Reaktivität: Human, Hund, Meerschweinchen, Pferd, Fledermaus, Affe WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ANGPTL5 Blocking Peptide, catalog no. 33R-1512, is also available for use as a blocking control in assays to test for specificity of this ANGPTL5 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANGPTL5 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ANGPTL5 (Angiopoietin-Like 5 (ANGPTL5))
- Andere Bezeichnung
- ANGPTL5 (ANGPTL5 Produkte)
- Synonyme
- AGF antikoerper, ARP5 antikoerper, ANGPTL5 antikoerper, bZ1P14.8 antikoerper, wu:fe36e01 antikoerper, si:rp71-1p14.8 antikoerper, angiopoietin like 5 antikoerper, angiopoietin like 6 antikoerper, angiopoietin-like 5 antikoerper, ANGPTL5 antikoerper, ANGPTL6 antikoerper, angptl5 antikoerper, Angptl5 antikoerper
- Hintergrund
- The function of ANGPTL5 has not been widely studied, and is yet to be fully elucidated.
- Molekulargewicht
- 44 kDa (MW of target protein)
-
