FCN1 Antikörper
-
- Target Alle FCN1 Antikörper anzeigen
- FCN1 (Ficolin (Collagen/fibrinogen Domain Containing) 1 (FCN1))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser FCN1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- FCN1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GSQLGEFWLGNDNIHALTAQGSSELRVDLVDFEGNHQFAKYKSFKVADEA
- Top Product
- Discover our top product FCN1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
FCN1 Blocking Peptide, catalog no. 33R-3578, is also available for use as a blocking control in assays to test for specificity of this FCN1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FCN1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FCN1 (Ficolin (Collagen/fibrinogen Domain Containing) 1 (FCN1))
- Andere Bezeichnung
- FCN1 (FCN1 Produkte)
- Synonyme
- FCNM antikoerper, FCNB antikoerper, FCN2 antikoerper, FCN1 antikoerper, ficolin 1 antikoerper, ficolin (collagen/fibrinogen domain containing) 1 antikoerper, ficolin-1 antikoerper, FCN1 antikoerper, Fcn1 antikoerper, LOC100069029 antikoerper
- Hintergrund
- The ficolin family of proteins are characterized by the presence of a leader peptide, a short N-terminal segment, followed by a collagen-like region, and a C-terminal fibrinogen-like domain. The collagen-like and the fibrinogen-like domains are also found separately in other proteins such as complement protein C1q, C-type lectins known as collectins, and tenascins. However, all these proteins recognise different targets, and are functionally distinct. Ficolin 1(FCN1) is predominantly expressed in the peripheral blood leukocytes, and has been postulated to function as a plasma protein with elastin-binding activity.
- Molekulargewicht
- 32 kDa (MW of target protein)
- Pathways
- Komplementsystem
-