Nucleobindin 1 Antikörper (C-Term)

Produktnummer ABIN633980

Produktdetails anti-Nucleobindin 1 Antikörper

Target: Nucleobindin 1 (NUCB1)

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Nucleobindin 1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Nucleobindin 1 antibody was raised against the C terminal of NUCB1

Aufreinigung: Affinity purified

Immunogen: Nucleobindin 1 antibody was raised using the C terminal of NUCB1 corresponding to a region with amino acids PAAHPEGQLKFHPDTDDVPVPAPAGDQKEVDTSEKKLLERLPEVEVPQHL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Nucleobindin 1 Blocking Peptide, catalog no. 33R-6951, is also available for use as a blocking control in assays to test for specificity of this Nucleobindin 1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NUCB1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Nucleobindin 1

Target: Nucleobindin 1 (NUCB1)

Andere Bezeichnung: Nucleobindin 1 (NUCB1 Produkte)

Synonyme: nuc antikoerper, MGC69294 antikoerper, MGC81496 antikoerper, NUCB1 antikoerper, zgc:153192 antikoerper, DKFZp459O1814 antikoerper, B230337F23Rik antikoerper, C77483 antikoerper, Calnuc antikoerper, MTEST82 antikoerper, Nucb antikoerper, CALNUC antikoerper, NUC antikoerper, nucleobindin 1 antikoerper, nucleobindin 1 S homeolog antikoerper, nucb1 antikoerper, nucb1.S antikoerper, NUCB1 antikoerper, Nucb1 antikoerper

Hintergrund: Nucleobindin, also known as calnuc, participates in Ca2+ storage in the Golgi, as well as in other biological processes that involve DNA-binding and protein-protein interactions.

Molekulargewicht: 54 kDa (MW of target protein)