LYPD6 Antikörper (Middle Region)

Produktnummer ABIN633991

Produktdetails anti-LYPD6 Antikörper

Target: LYPD6 (LY6/PLAUR Domain Containing 6 (LYPD6))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LYPD6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: LYPD6 antibody was raised against the middle region of LYPD6

Aufreinigung: Affinity purified

Immunogen: LYPD6 antibody was raised using the middle region of LYPD6 corresponding to a region with amino acids RDSEHEGHKVCTSCCEGNICNLPLPRNETDATFATTSPINQTNGHPRCMS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LYPD6 Blocking Peptide, catalog no. 33R-7859, is also available for use as a blocking control in assays to test for specificity of this LYPD6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LYPD6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LYPD6

Target: LYPD6 (LY6/PLAUR Domain Containing 6 (LYPD6))

Andere Bezeichnung: LYPD6 (LYPD6 Produkte)

Synonyme: zgc:101899 antikoerper, DKFZp459C1429 antikoerper, E130115E03Rik antikoerper, LY6/PLAUR domain containing 6 antikoerper, lypd6 antikoerper, LYPD6 antikoerper, Lypd6 antikoerper

Hintergrund: LYPD6 contains 1 UPAR/Ly6 domain. The exact function of LYPD6 is not known.

Molekulargewicht: 19 kDa (MW of target protein)