APOH Antikörper
-
- Target Alle APOH Antikörper anzeigen
- APOH (Apolipoprotein H (Beta-2-Glycoprotein I) (APOH))
-
Reaktivität
- Human, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser APOH Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- ApoH antibody was raised using a synthetic peptide corresponding to a region with amino acids LWPINTLKCTPRVCPFAGILENGAVRYTTFEYPNTISFSCNTGFYLNGAD
- Top Product
- Discover our top product APOH Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ApoH Blocking Peptide, catalog no. 33R-5558, is also available for use as a blocking control in assays to test for specificity of this ApoH antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APOH antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- APOH (Apolipoprotein H (Beta-2-Glycoprotein I) (APOH))
- Andere Bezeichnung
- ApoH (APOH Produkte)
- Synonyme
- B2G1 antikoerper, B2GP1 antikoerper, BG antikoerper, BETA2 antikoerper, BHF-1 antikoerper, MODY6 antikoerper, NEUROD antikoerper, bHLHa3 antikoerper, apoh antikoerper, APOH antikoerper, B2GPI antikoerper, beta-2-GPI antikoerper, beta2-GPI antikoerper, LOC100227913 antikoerper, apolipoprotein H antikoerper, neuronal differentiation 1 antikoerper, APOH antikoerper, NEUROD1 antikoerper, apoh antikoerper, Apoh antikoerper
- Hintergrund
- Apolipoprotein H has been implicated in a variety of physiologic pathways including lipoprotein metabolism, coagulation, and the production of antiphospholipid autoantibodies. APOH may be a required cofactor for anionic phospholipid binding by the antiphospholipid autoantibodies found in sera of many patients with lupus and primary antiphospholipid syndrome, but it does not seem to be required for the reactivity of antiphospholipid autoantibodies associated with infections.
- Molekulargewicht
- 36 kDa (MW of target protein)
-