FETUB Antikörper (N-Term)
-
- Target Alle FETUB Antikörper anzeigen
- FETUB (Fetuin B (FETUB))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser FETUB Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- FETUB antibody was raised against the N terminal of FETUB
- Aufreinigung
- Affinity purified
- Immunogen
- FETUB antibody was raised using the N terminal of FETUB corresponding to a region with amino acids GCNDSDVLAVAGFALRDINKDRKDGYVLRLNRVNDAQEYRRGGLGSLFYL
- Top Product
- Discover our top product FETUB Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
FETUB Blocking Peptide, catalog no. 33R-3189, is also available for use as a blocking control in assays to test for specificity of this FETUB antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FETUB antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FETUB (Fetuin B (FETUB))
- Andere Bezeichnung
- FETUB (FETUB Produkte)
- Hintergrund
- The protein encoded by this gene is a member of the fetuin family, part of the cystatin superfamily of cysteine protease inhibitors. Fetuins have been implicated in several diverse functions, including osteogenesis and bone resorption.
- Molekulargewicht
- 42 kDa (MW of target protein)
-