IFNA7 Antikörper (N-Term)
-
- Target Alle IFNA7 (IFNa7) Antikörper anzeigen
- IFNA7 (IFNa7) (Interferon, alpha 7 (IFNa7))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser IFNA7 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- IFN Alpha 7 antibody was raised against the N terminal of IFNA7
- Aufreinigung
- Affinity purified
- Immunogen
- IFN Alpha 7 antibody was raised using the N terminal of IFNA7 corresponding to a region with amino acids RALILLAQMGRISPFSCLKDRHEFRFPEEEFDGHQFQKTQAISVLHEMIQ
- Top Product
- Discover our top product IFNa7 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
IFN Alpha 7 Blocking Peptide, catalog no. 33R-7815, is also available for use as a blocking control in assays to test for specificity of this IFN Alpha 7 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IFNA7 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- IFNA7 (IFNa7) (Interferon, alpha 7 (IFNa7))
- Andere Bezeichnung
- IFN alpha 7 (IFNa7 Produkte)
- Hintergrund
- IFNA7 belongs to the alpha/beta interferon family. IFNA7 is produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.
- Molekulargewicht
- 22 kDa (MW of target protein)
- Pathways
- JAK-STAT Signalweg, Hepatitis C
-