PDIA6 Antikörper (N-Term)

Produktnummer ABIN634007

Produktdetails anti-PDIA6 Antikörper

Target: PDIA6 (Protein Disulfide Isomerase Family A, Member 6 (PDIA6))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PDIA6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PDIA6 antibody was raised against the N terminal of PDIA6

Aufreinigung: Affinity purified

Immunogen: PDIA6 antibody was raised using the N terminal of PDIA6 corresponding to a region with amino acids KNRPEDYQGGRTGEAIVDAALSALRQLVKDRLGGRSGGYSSGKQGRSDSS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PDIA6 Blocking Peptide, catalog no. 33R-4571, is also available for use as a blocking control in assays to test for specificity of this PDIA6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDIA6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PDIA6

Target: PDIA6 (Protein Disulfide Isomerase Family A, Member 6 (PDIA6))

Andere Bezeichnung: PDIA6 (PDIA6 Produkte)

Synonyme: 1700015E05Rik antikoerper, AL023058 antikoerper, C77895 antikoerper, CaBP5 antikoerper, P5 antikoerper, Txndc7 antikoerper, ERP5 antikoerper, TXNDC7 antikoerper, CaBP1 antikoerper, pdi-p5 antikoerper, erp5 antikoerper, pdia6 antikoerper, pdip5 antikoerper, txndc7 antikoerper, protein disulfide isomerase family A member 6 antikoerper, protein disulfide isomerase associated 6 antikoerper, protein disulfide isomerase family A, member 6 antikoerper, protein disulfide isomerase family A member 6 L homeolog antikoerper, PDIA6 antikoerper, Pdia6 antikoerper, pdia6.L antikoerper

Hintergrund: Protein disulfide isomerases, such as PDIA6, are endoplasmic reticulum (ER) resident proteins that catalyze formation, reduction, and isomerization of disulfide bonds in proteins and are thought to play a role in folding of disulfide-bonded proteins.

Molekulargewicht: 48 kDa (MW of target protein)

Pathways: ER-Nucleus Signaling, Cell RedoxHomeostasis