DAO Antikörper (C-Term)
-
- Target Alle DAO (ABP1) Antikörper anzeigen
- DAO (ABP1) (Amiloride Binding Protein 1 (Amine Oxidase (Copper-Containing)) (ABP1))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser DAO Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- ABP1 antibody was raised against the C terminal of ABP1
- Aufreinigung
- Affinity purified
- Immunogen
- ABP1 antibody was raised using the C terminal of ABP1 corresponding to a region with amino acids QFLHNNENIENEDLVAWVTVGFLHIPHSEDIPNTATPGNSVGFLLRPFNF
- Top Product
- Discover our top product ABP1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ABP1 Blocking Peptide, catalog no. 33R-7547, is also available for use as a blocking control in assays to test for specificity of this ABP1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABP1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DAO (ABP1) (Amiloride Binding Protein 1 (Amine Oxidase (Copper-Containing)) (ABP1))
- Andere Bezeichnung
- ABP1 (ABP1 Produkte)
- Hintergrund
- ABP1 is a membrane glycoprotein that is expressed in many epithelium-rich and/or hematopoietic tissues and oxidatively deaminates putrescine and histamine. The protein may play a role in controlling the level of histamine and/or putrescine in these tissues. It also binds to and is inhibited by amiloride, a diuretic that acts by closing epithelial sodium ion channels.
- Molekulargewicht
- 83 kDa (MW of target protein)
-