DAO Antikörper (C-Term)

Produktnummer ABIN634013

Produktdetails anti-DAO Antikörper

Target: DAO (ABP1) (Amiloride Binding Protein 1 (Amine Oxidase (Copper-Containing)) (ABP1))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DAO Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: ABP1 antibody was raised against the C terminal of ABP1

Aufreinigung: Affinity purified

Immunogen: ABP1 antibody was raised using the C terminal of ABP1 corresponding to a region with amino acids QFLHNNENIENEDLVAWVTVGFLHIPHSEDIPNTATPGNSVGFLLRPFNF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ABP1 Blocking Peptide, catalog no. 33R-7547, is also available for use as a blocking control in assays to test for specificity of this ABP1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABP1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DAO

Target: DAO (ABP1) (Amiloride Binding Protein 1 (Amine Oxidase (Copper-Containing)) (ABP1))

Andere Bezeichnung: ABP1 (ABP1 Produkte)

Synonyme: ABP antikoerper, ABP1 antikoerper, DAO antikoerper, DAO1 antikoerper, KAO antikoerper, 1600012D06Rik antikoerper, Abp1 antikoerper, abp1 antikoerper, si:ch211-286c5.2 antikoerper, zgc:154101 antikoerper, Abp antikoerper, dao antikoerper, amine oxidase, copper containing 1 antikoerper, amine oxidase, copper-containing 1 antikoerper, AOC1 antikoerper, Aoc1 antikoerper, aoc1 antikoerper

Hintergrund: ABP1 is a membrane glycoprotein that is expressed in many epithelium-rich and/or hematopoietic tissues and oxidatively deaminates putrescine and histamine. The protein may play a role in controlling the level of histamine and/or putrescine in these tissues. It also binds to and is inhibited by amiloride, a diuretic that acts by closing epithelial sodium ion channels.

Molekulargewicht: 83 kDa (MW of target protein)