ZG16 Antikörper (Middle Region)

Produktnummer ABIN634014

Produktdetails anti-ZG16 Antikörper

Target: ZG16 (Zymogen Granule Protein 16 (ZG16))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ZG16 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ZG16 antibody was raised against the middle region of ZG16

Aufreinigung: Affinity purified

Immunogen: ZG16 antibody was raised using the middle region of ZG16 corresponding to a region with amino acids WSDYVGGRNGDLEEIFLHPGESVIQVSGKYKWYLKKLVFVTDKGRYLSFG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ZG16 Blocking Peptide, catalog no. 33R-10009, is also available for use as a blocking control in assays to test for specificity of this ZG16 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZG16 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ZG16

Target: ZG16 (Zymogen Granule Protein 16 (ZG16))

Andere Bezeichnung: ZG16 (ZG16 Produkte)

Synonyme: JCLN antikoerper, JCLN1 antikoerper, ZG16A antikoerper, Zg-16p antikoerper, Zg16p antikoerper, 1810010M01Rik antikoerper, AI593689 antikoerper, ZG16p antikoerper, zymogen granule protein 16 antikoerper, ZG16 antikoerper, Zg16 antikoerper

Hintergrund: ZG16 may act as a linker molecule between the submembranous matrix on the luminal side of zymogen granule membrane (ZGM) and aggregated secretory proteins during granule formation in the TGN.

Molekulargewicht: 18 kDa (MW of target protein)