CPB1 Antikörper
-
- Target Alle CPB1 Antikörper anzeigen
- CPB1 (Carboxypeptidase B1 (Tissue) (CPB1))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CPB1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- Carboxypeptidase B1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SRVRATGHSYEKYNKWETIEAWTQQVATENPALISRSVIGTTFEGRAIYL
- Top Product
- Discover our top product CPB1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Carboxypeptidase B1 Blocking Peptide, catalog no. 33R-8785, is also available for use as a blocking control in assays to test for specificity of this Carboxypeptidase B1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CPB1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CPB1 (Carboxypeptidase B1 (Tissue) (CPB1))
- Andere Bezeichnung
- Carboxypeptidase B1 (CPB1 Produkte)
- Synonyme
- wu:fb60d07 antikoerper, wu:fb69b08 antikoerper, CPB1 antikoerper, pCPB antikoerper, CPB antikoerper, PASP antikoerper, PCPB antikoerper, Cpb antikoerper, 0910001A18Rik antikoerper, 1810063F02Rik antikoerper, 2210008M23Rik antikoerper, AI504870 antikoerper, carboxypeptidase B1 (tissue) antikoerper, carboxypeptidase B1 antikoerper, carboxypeptidase B1 S homeolog antikoerper, carboxypeptidase B antikoerper, cpb1 antikoerper, CPB1 antikoerper, cpb1.S antikoerper, CpipJ_CPIJ010799 antikoerper, CpipJ_CPIJ010801 antikoerper, VDBG_02663 antikoerper, LOC100562609 antikoerper, Cpb1 antikoerper
- Hintergrund
- Three different procarboxypeptidases A and two different procarboxypeptidases B have been isolated. The B1 and B2 forms differ from each other mainly in isoelectric point. Carboxypeptidase B1 is a highly tissue-specific protein and is a useful serum marker for acute pancreatitis and dysfunction of pancreatic transplants. It is not elevated in pancreatic carcinoma.
- Molekulargewicht
- 35 kDa (MW of target protein)
-