OLFML1 Antikörper (N-Term)

Produktnummer ABIN634027

Produktdetails anti-OLFML1 Antikörper

Target: OLFML1 (Olfactomedin-Like 1 (OLFML1))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser OLFML1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: OLFML1 antibody was raised against the N terminal of OLFML1

Aufreinigung: Affinity purified

Immunogen: OLFML1 antibody was raised using the N terminal of OLFML1 corresponding to a region with amino acids IYQRFRVLEQGLEKCTQATRAYIQEFQEFSKNISVMLGRCQTYTSEYKSA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

OLFML1 Blocking Peptide, catalog no. 33R-4224, is also available for use as a blocking control in assays to test for specificity of this OLFML1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OLFML1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu OLFML1

Target: OLFML1 (Olfactomedin-Like 1 (OLFML1))

Andere Bezeichnung: OLFML1 (OLFML1 Produkte)

Synonyme: UNQ564 antikoerper, 6720478C22 antikoerper, AV321997 antikoerper, BC047207 antikoerper, MVAL564 antikoerper, ONT2 antikoerper, mONT2 antikoerper, olfactomedin like 1 antikoerper, olfactomedin-like 1 antikoerper, OLFML1 antikoerper, Olfml1 antikoerper

Hintergrund: The function of OLFML1 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 46 kDa (MW of target protein)