LYPD4 Antikörper (N-Term)
-
- Target Alle LYPD4 Antikörper anzeigen
- LYPD4 (LY6/PLAUR Domain Containing 4 (LYPD4))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser LYPD4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- LYPD4 antibody was raised against the N terminal of LYPD4
- Aufreinigung
- Affinity purified
- Immunogen
- LYPD4 antibody was raised using the N terminal of LYPD4 corresponding to a region with amino acids MGPQHLRLVQLFCLLGAISTLPRAGALLCYEATASRFRAVAFHNWKWLLM
- Top Product
- Discover our top product LYPD4 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
LYPD4 Blocking Peptide, catalog no. 33R-6059, is also available for use as a blocking control in assays to test for specificity of this LYPD4 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LYPD4 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LYPD4 (LY6/PLAUR Domain Containing 4 (LYPD4))
- Andere Bezeichnung
- LYPD4 (LYPD4 Produkte)
- Synonyme
- LYPD4 antikoerper, SMR antikoerper, 4933400F01Rik antikoerper, rCG53718 antikoerper, LY6/PLAUR domain containing 4 antikoerper, Ly6/Plaur domain containing 4 antikoerper, LYPD4 antikoerper, Lypd4 antikoerper
- Hintergrund
- The specific function of LYPD4 is not yet known.
- Molekulargewicht
- 27 kDa (MW of target protein)
-