FCN3 Antikörper (N-Term)

Produktnummer ABIN634029

Produktdetails anti-FCN3 Antikörper

Target: FCN3 (Ficolin (Collagen/fibrinogen Domain Containing) 3 (Hakata Antigen) (FCN3))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FCN3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: FCN3 antibody was raised against the N terminal of FCN3

Aufreinigung: Affinity purified

Immunogen: FCN3 antibody was raised using the N terminal of FCN3 corresponding to a region with amino acids LEASKVVLLPSCPGAPGSPGEKGAPGPQGPPGPPGKMGPKGEPGDPVNLL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FCN3 Blocking Peptide, catalog no. 33R-4879, is also available for use as a blocking control in assays to test for specificity of this FCN3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FCN3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FCN3

Target: FCN3 (Ficolin (Collagen/fibrinogen Domain Containing) 3 (Hakata Antigen) (FCN3))

Andere Bezeichnung: FCN3 (FCN3 Produkte)

Synonyme: FCNH antikoerper, HAKA1 antikoerper, ficolin 3 antikoerper, ficolin-3 antikoerper, FCN3 antikoerper, Fcn3 antikoerper, fcn3-A antikoerper

Hintergrund: Ficolins are a group of proteins which consist of a collagen-like domain and a fibrinogen-like domain. In human serum, there are two types of ficolins, both of which have lectin activity.

Molekulargewicht: 31 kDa (MW of target protein)

Pathways: Komplementsystem