LYZL6 Antikörper (N-Term)

Produktnummer ABIN634036

Produktdetails anti-LYZL6 Antikörper

Target: LYZL6 (Lysozyme-Like 6 (LYZL6))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LYZL6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: LYZL6 antibody was raised against the N terminal of LYZL6

Aufreinigung: Affinity purified

Immunogen: LYZL6 antibody was raised using the N terminal of LYZL6 corresponding to a region with amino acids MTKALLIYLVSSFLALNQASLISRCDLAQVLQLEDLDGFEGYSLSDWLCL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LYZL6 Blocking Peptide, catalog no. 33R-6547, is also available for use as a blocking control in assays to test for specificity of this LYZL6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LYZL6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LYZL6

Target: LYZL6 (Lysozyme-Like 6 (LYZL6))

Andere Bezeichnung: LYZL6 (LYZL6 Produkte)

Synonyme: LYC1 antikoerper, PRO1485 antikoerper, TKAL754 antikoerper, UNQ754 antikoerper, 1700023H08Rik antikoerper, Lyc1 antikoerper, RGD1306968 antikoerper, lysozyme like 6 antikoerper, lysozyme-like protein 6 antikoerper, lysozyme-like 6 antikoerper, LYZL6 antikoerper, LOC480492 antikoerper, Lyzl6 antikoerper

Hintergrund: LYZL6 belongs to the glycosyl hydrolase 22 family. The exact function of LYZL6 remains unknown.

Molekulargewicht: 16 kDa (MW of target protein)