CPQ Antikörper (N-Term)

Produktnummer ABIN634040

Produktdetails anti-CPQ Antikörper

Target: CPQ (Carboxypeptidase Q (CPQ))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CPQ Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PGCP antibody was raised against the N terminal of PGCP

Aufreinigung: Affinity purified

Immunogen: PGCP antibody was raised using the N terminal of PGCP corresponding to a region with amino acids VDTVGPRLSGSKNLEKAIQIMYQNLQQDGLEKVHLEPVRIPHWERGEESA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PGCP Blocking Peptide, catalog no. 33R-9484, is also available for use as a blocking control in assays to test for specificity of this PGCP antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PGCP antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CPQ

Target: CPQ (Carboxypeptidase Q (CPQ))

Andere Bezeichnung: PGCP (CPQ Produkte)

Synonyme: LDP antikoerper, PGCP antikoerper, 1190003P12Rik antikoerper, 2610034C17Rik antikoerper, Hls2 antikoerper, Lal-1 antikoerper, Pgcp antikoerper, LAL antikoerper, lal-1 antikoerper, MGC80390 antikoerper, pgcp antikoerper, carboxypeptidase Q antikoerper, carboxypeptidase Q L homeolog antikoerper, CPQ antikoerper, Cpq antikoerper, cpq.L antikoerper

Hintergrund: PGCP is a carboxypeptidase that may play an important role in the hydrolysis of circulating peptides.

Molekulargewicht: 52 kDa (MW of target protein)