CES5A Antikörper (N-Term)
-
- Target Alle CES5A Antikörper anzeigen
- CES5A (Carboxylesterase 5A (CES5A))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CES5A Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Carboxylesterase 7 antibody was raised against the N terminal of CES7
- Aufreinigung
- Affinity purified
- Immunogen
- Carboxylesterase 7 antibody was raised using the N terminal of CES7 corresponding to a region with amino acids SGNWVHPGQILIWAIWVLAAPTKGPSAEGPQRNTRLGWIQGKQVTVLGSP
- Top Product
- Discover our top product CES5A Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Carboxylesterase 7 Blocking Peptide, catalog no. 33R-8476, is also available for use as a blocking control in assays to test for specificity of this Carboxylesterase 7 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CES7 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CES5A (Carboxylesterase 5A (CES5A))
- Andere Bezeichnung
- Carboxylesterase 7 (CES5A Produkte)
- Hintergrund
- CES7 belongs to the type-B carboxylesterase/lipase family. It is involved in the detoxification of xenobiotics and in the activation of ester and amide prodrugs.
- Molekulargewicht
- 58 kDa (MW of target protein)
-