BMPER Antikörper (C-Term)
-
- Target Alle BMPER Antikörper anzeigen
- BMPER (BMP Binding Endothelial Regulator (BMPER))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser BMPER Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- BMPER antibody was raised against the C terminal of BMPER
- Aufreinigung
- Affinity purified
- Immunogen
- BMPER antibody was raised using the C terminal of BMPER corresponding to a region with amino acids NGHKRDDLIGGDGNFKFDVDDFAESWRVESNEFCNRPQRKPVPELCQGTV
- Top Product
- Discover our top product BMPER Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
BMPER Blocking Peptide, catalog no. 33R-6702, is also available for use as a blocking control in assays to test for specificity of this BMPER antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BMPER antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- BMPER (BMP Binding Endothelial Regulator (BMPER))
- Andere Bezeichnung
- BMPER (BMPER Produkte)
- Hintergrund
- BMPER contains 1 TIL (trypsin inhibitory-like) domain, 5 VWFC domains and 1 VWFD domain.BMPER is the inhibitor of bone morphogenetic protein (BMP) functions. It may regulate BMP responsiveness of osteoblasts and chondrocytes.
- Molekulargewicht
- 76 kDa (MW of target protein)
-