BMPER Antikörper (C-Term)

Produktnummer ABIN634046

Produktdetails anti-BMPER Antikörper

Target: BMPER (BMP Binding Endothelial Regulator (BMPER))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser BMPER Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: BMPER antibody was raised against the C terminal of BMPER

Aufreinigung: Affinity purified

Immunogen: BMPER antibody was raised using the C terminal of BMPER corresponding to a region with amino acids NGHKRDDLIGGDGNFKFDVDDFAESWRVESNEFCNRPQRKPVPELCQGTV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

BMPER Blocking Peptide, catalog no. 33R-6702, is also available for use as a blocking control in assays to test for specificity of this BMPER antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BMPER antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu BMPER

Target: BMPER (BMP Binding Endothelial Regulator (BMPER))

Andere Bezeichnung: BMPER (BMPER Produkte)

Synonyme: BMPER antikoerper, CG15671 antikoerper, CT35855 antikoerper, Cv 2 antikoerper, Cv-2 antikoerper, Cv2 antikoerper, Dmel\\CG15671 antikoerper, cv 2 antikoerper, CV2 antikoerper, cv-2 antikoerper, crim3 antikoerper, cv2 antikoerper, cvl2 antikoerper, id:ibd5071 antikoerper, CV-2 antikoerper, CRIM3 antikoerper, 3110056H04Rik antikoerper, Crim3 antikoerper, RGD1563373 antikoerper, BMP binding endothelial regulator antikoerper, crossveinless 2 antikoerper, BMP-binding endothelial regulator protein antikoerper, BMP binding endothelial regulator L homeolog antikoerper, BMP-binding endothelial regulator antikoerper, BMPER antikoerper, cv-2 antikoerper, bmper antikoerper, LOC100070275 antikoerper, cv2 antikoerper, bmper.L antikoerper, Bmper antikoerper

Hintergrund: BMPER contains 1 TIL (trypsin inhibitory-like) domain, 5 VWFC domains and 1 VWFD domain.BMPER is the inhibitor of bone morphogenetic protein (BMP) functions. It may regulate BMP responsiveness of osteoblasts and chondrocytes.

Molekulargewicht: 76 kDa (MW of target protein)