PRSS35 Antikörper (N-Term)

Produktnummer ABIN634047

Produktdetails anti-PRSS35 Antikörper

Target: PRSS35 (Protease, serine, 35 (PRSS35))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PRSS35 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PRSS35 antibody was raised against the N terminal of PRSS35

Aufreinigung: Affinity purified

Immunogen: PRSS35 antibody was raised using the N terminal of PRSS35 corresponding to a region with amino acids PTQNITTKGVSVRRKRQVYGTDSRFSILDKRFLTNFPFSTAVKLSTGCSG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PRSS35 Blocking Peptide, catalog no. 33R-7394, is also available for use as a blocking control in assays to test for specificity of this PRSS35 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRSS35 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PRSS35

Target: PRSS35 (Protease, serine, 35 (PRSS35))

Andere Bezeichnung: PRSS35 (PRSS35 Produkte)

Synonyme: zgc:91804 antikoerper, C6orf158 antikoerper, dJ223E3.1 antikoerper, 6030424L22Rik antikoerper, P3D9 antikoerper, protease, serine, 35 antikoerper, protease, serine 35 antikoerper, prss35 antikoerper, PRSS35 antikoerper, Prss35 antikoerper

Hintergrund: The function of PRSS35 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 47 kDa (MW of target protein)