CREG2 Antikörper (N-Term)
-
- Target Alle CREG2 Produkte
- CREG2 (Cellular Repressor of E1A-Stimulated Genes 2 (CREG2))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CREG2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- CREG2 antibody was raised against the N terminal of CREG2
- Aufreinigung
- Affinity purified
- Immunogen
- CREG2 antibody was raised using the N terminal of CREG2 corresponding to a region with amino acids VSSVSWAVTNEVDEELDSASTEEAMPALLEDSGSIWQQSFPASAHKEDAH
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CREG2 Blocking Peptide, catalog no. 33R-9827, is also available for use as a blocking control in assays to test for specificity of this CREG2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CREG2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CREG2 (Cellular Repressor of E1A-Stimulated Genes 2 (CREG2))
- Andere Bezeichnung
- CREG2 (CREG2 Produkte)
- Synonyme
- zgc:92257 antikoerper, A830098L22Rik antikoerper, Creg2-ps1 antikoerper, RGD1564056 antikoerper, cellular repressor of E1A-stimulated genes 2 antikoerper, cellular repressor of E1A stimulated genes 2 antikoerper, creg2 antikoerper, CREG2 antikoerper, Creg2 antikoerper
- Hintergrund
- The function of CREG2 has not been widely studied, and is yet to be fully elucidated.
- Molekulargewicht
- 32 kDa (MW of target protein)
-