DHRS9 Antikörper
-
- Target Alle DHRS9 Antikörper anzeigen
- DHRS9 (Dehydrogenase/reductase (SDR Family) Member 9 (DHRS9))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser DHRS9 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- DHRS9 antibody was raised using a synthetic peptide corresponding to a region with amino acids DPVKVIEKKLAIWEQLSPDIKQQYGEGYIEKSLDKLKGNKSYVNMDLSPV
- Top Product
- Discover our top product DHRS9 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
DHRS9 Blocking Peptide, catalog no. 33R-2120, is also available for use as a blocking control in assays to test for specificity of this DHRS9 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DHRS9 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DHRS9 (Dehydrogenase/reductase (SDR Family) Member 9 (DHRS9))
- Andere Bezeichnung
- DHRS9 (DHRS9 Produkte)
- Synonyme
- 3ALPHA-HSD antikoerper, RDH-TBE antikoerper, RDH15 antikoerper, RDHL antikoerper, RDHTBE antikoerper, RETSDR8 antikoerper, SDR9C4 antikoerper, Rdhl antikoerper, C730025I08Rik antikoerper, Rdh15 antikoerper, rdhl antikoerper, 3alpha-hsd antikoerper, rdh15 antikoerper, retsdr8 antikoerper, DHRS9 antikoerper, RDHA antikoerper, rdh1l antikoerper, wu:fb64b07 antikoerper, zgc:73286 antikoerper, dehydrogenase/reductase 9 antikoerper, dehydrogenase/reductase (SDR family) member 9 antikoerper, dehydrogenase/reductase (SDR family) member 9 L homeolog antikoerper, DHRS9 antikoerper, Dhrs9 antikoerper, dhrs9.L antikoerper, dhrs9 antikoerper
- Hintergrund
- DHRS9 is a 3-alpha-hydroxysteroid dehydrogenase that converts 3-alpha-tetrahydroprogesterone (allopregnanolone) to dihydroxyprogesterone and 3-alpha-androstanediol to dihydroxyprogesterone.
- Molekulargewicht
- 35 kDa (MW of target protein)
- Pathways
- C21-Steroid Hormone Metabolic Process
-