PCOLCE Antikörper (Middle Region)
-
- Target Alle PCOLCE Antikörper anzeigen
- PCOLCE (Procollagen C-Endopeptidase Enhancer (PCOLCE))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PCOLCE Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PCOLCE antibody was raised against the middle region of PCOLCE
- Aufreinigung
- Affinity purified
- Immunogen
- PCOLCE antibody was raised using the middle region of PCOLCE corresponding to a region with amino acids LLVQFVSDLSVTADGFSASYKTLPRGTAKEGQGPGPKRGTEPKVKLPPKS
- Top Product
- Discover our top product PCOLCE Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PCOLCE Blocking Peptide, catalog no. 33R-5197, is also available for use as a blocking control in assays to test for specificity of this PCOLCE antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCOLCE antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PCOLCE (Procollagen C-Endopeptidase Enhancer (PCOLCE))
- Andere Bezeichnung
- PCOLCE (PCOLCE Produkte)
- Synonyme
- PCPE antikoerper, PCPE-1 antikoerper, PCPE1 antikoerper, Astt-2 antikoerper, Astt2 antikoerper, P14 antikoerper, procollagen C-endopeptidase enhancer antikoerper, procollagen C-endopeptidase enhancer L homeolog antikoerper, procollagen C-endopeptidase enhancer protein antikoerper, PCOLCE antikoerper, Pcolce antikoerper, pcolce.L antikoerper
- Hintergrund
- PCOLCE binds to the C-terminal propeptide of type I procollagen and enhances procollagen C-proteinase activity.
- Molekulargewicht
- 48 kDa (MW of target protein)
-