RANGAP1 Antikörper (N-Term)
-
- Target Alle RANGAP1 Antikörper anzeigen
- RANGAP1 (Ran GTPase Activating Protein 1 (RANGAP1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RANGAP1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- RanGAP1 antibody was raised against the N terminal of RANGAP1
- Aufreinigung
- Affinity purified
- Immunogen
- RanGAP1 antibody was raised using the N terminal of RANGAP1 corresponding to a region with amino acids MASEDIAKLAETLAKTQVAGGQLSFKGKSLKLNTAEDAKDVIKEIEDFDS
- Top Product
- Discover our top product RANGAP1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RanGAP1 Blocking Peptide, catalog no. 33R-5742, is also available for use as a blocking control in assays to test for specificity of this RanGAP1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RANGAP1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RANGAP1 (Ran GTPase Activating Protein 1 (RANGAP1))
- Andere Bezeichnung
- RanGAP1 (RANGAP1 Produkte)
- Synonyme
- Fug1 antikoerper, RANGAP antikoerper, SD antikoerper, ATRANGAP1 antikoerper, RAN GTPASE-ACTIVATING PROTEIN 1 antikoerper, RAN GTPase activating protein 1 antikoerper, RanGAP1 antikoerper, fug1 antikoerper, rangap1b antikoerper, rna1p antikoerper, C79654 antikoerper, mKIAA1835 antikoerper, rangap1 antikoerper, rangap1a antikoerper, Protein rna1 antikoerper, CG9999 antikoerper, CT28175 antikoerper, Dmel\CG9999 antikoerper, RGP1_DROME antikoerper, Ran antikoerper, RanGAP antikoerper, RanGap antikoerper, RanGap1 antikoerper, Scl antikoerper, Sd antikoerper, Sd-RanGAP antikoerper, Sd-RanGap antikoerper, dRanGAP antikoerper, ranGAP antikoerper, ranGap antikoerper, rangap antikoerper, zgc:154097 antikoerper, Ran GTPase activating protein 1 antikoerper, RAN GTPase activating protein 1 antikoerper, ran GTPase activating protein 1 antikoerper, Ran GTPase activating protein 1 S homeolog antikoerper, Ran GTPase activating protein 1 L homeolog antikoerper, Ran GAP Rna1 antikoerper, Ran GTPase activating protein antikoerper, RAN GTPase activating protein 1a antikoerper, RANGAP1 antikoerper, TERG_02084 antikoerper, rangap1.S antikoerper, Rangap1 antikoerper, rangap1.L antikoerper, rna1 antikoerper, RanGAP antikoerper, rangap1a antikoerper
- Hintergrund
- RanGAP1, is a homodimeric 65 kDa polypeptide that specifically induces the GTPase activity of RAN, but not of RAS by over 1,000-fold. RanGAP1 is the immediate antagonist of RCC1, a regulator molecule that keeps RAN in the active, GTP-bound state.
- Molekulargewicht
- 63 kDa (MW of target protein)
- Pathways
- M Phase, Protein targeting to Nucleus
-