KLHDC4 Antikörper (N-Term)
-
- Target Alle KLHDC4 Produkte
- KLHDC4 (Kelch Domain Containing 4 (KLHDC4))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser KLHDC4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- KLHDC4 antibody was raised against the N terminal of KLHDC4
- Aufreinigung
- Affinity purified
- Immunogen
- KLHDC4 antibody was raised using the N terminal of KLHDC4 corresponding to a region with amino acids MGKKGKKEKKGRGAEKTAAKMEKKVSKRSRKEEEDLEALIAHFQTLDAKR
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
KLHDC4 Blocking Peptide, catalog no. 33R-6041, is also available for use as a blocking control in assays to test for specificity of this KLHDC4 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLHDC4 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KLHDC4 (Kelch Domain Containing 4 (KLHDC4))
- Andere Bezeichnung
- KLHDC4 (KLHDC4 Produkte)
- Synonyme
- AA408426 antikoerper, AV352552 antikoerper, BC012312 antikoerper, G430025P05Rik antikoerper, MGC53395 antikoerper, fb95f04 antikoerper, wu:fb95f04 antikoerper, RGD1561676 antikoerper, kelch domain containing 4 antikoerper, kelch domain containing 4 L homeolog antikoerper, KLHDC4 antikoerper, Klhdc4 antikoerper, klhdc4.L antikoerper, klhdc4 antikoerper
- Hintergrund
- KLHDC4 is involved in protein binding.
- Molekulargewicht
- 58 kDa (MW of target protein)
-