POFUT2 Antikörper (N-Term)
-
- Target Alle POFUT2 Antikörper anzeigen
- POFUT2 (Protein O-Fucosyltransferase 2 (POFUT2))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser POFUT2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- POFUT2 antibody was raised against the N terminal of POFUT2
- Aufreinigung
- Affinity purified
- Immunogen
- POFUT2 antibody was raised using the N terminal of POFUT2 corresponding to a region with amino acids GAASRRRYLLYDVNPPEGFNLRRDVYIRIASLLKTLLKTEEWVLVLPPWG
- Top Product
- Discover our top product POFUT2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
POFUT2 Blocking Peptide, catalog no. 33R-3149, is also available for use as a blocking control in assays to test for specificity of this POFUT2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of POFUT2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- POFUT2 (Protein O-Fucosyltransferase 2 (POFUT2))
- Andere Bezeichnung
- POFUT2 (POFUT2 Produkte)
- Hintergrund
- POFUT2 catalyzes the reaction that attaches fucose through an O-glycosidic linkage to a conserved serine or threonine residue in thrombospondin type 1 repeats. Fucose is typically found as a terminal modification of branched chain glycoconjugates, but it also exists in direct O-linkage to serine or threonine residues within cystine knot motifs in epidermal growth factor-like repeats or thrombospondin.
- Molekulargewicht
- 50 kDa (MW of target protein)
-