RDH16 Antikörper
-
- Target Alle RDH16 Antikörper anzeigen
- RDH16 (Retinol Dehydrogenase 16 (All-Trans) (RDH16))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RDH16 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- RDH16 antibody was raised using a synthetic peptide corresponding to a region with amino acids WLYLAVFVGLYYLLHWYRERQVLSHLRDKYVFITGCDSGFGKLLARQLDA
- Top Product
- Discover our top product RDH16 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RDH16 Blocking Peptide, catalog no. 33R-9976, is also available for use as a blocking control in assays to test for specificity of this RDH16 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RDH16 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RDH16 (Retinol Dehydrogenase 16 (All-Trans) (RDH16))
- Andere Bezeichnung
- RDH16 (RDH16 Produkte)
- Synonyme
- MGC68820 antikoerper, CRAD antikoerper, CRAD1 antikoerper, Rdh6 antikoerper, RODH-4 antikoerper, SDR9C8 antikoerper, Rdh2 antikoerper, RoDHII antikoerper, retinol dehydrogenase 16 (all-trans) L homeolog antikoerper, retinol dehydrogenase 16 (all-trans) antikoerper, retinol dehydrogenase 16 antikoerper, rdh16.L antikoerper, RDH16 antikoerper, rdh16 antikoerper, Rdh16 antikoerper
- Hintergrund
- RDH16 is an oxidoreductase with a preference for NAD. It oxidizes all-trans-retinol and 13-cis-retinol to the corresponding aldehydes. RDH16 has higher activity towards CRBP-bound retinol than with free retinol. It also oxidizes androstanediol and androsterone to dihydrotestosterone and androstanedione. RDH16 can also catalyze the reverse reaction.
- Molekulargewicht
- 36 kDa (MW of target protein)
- Pathways
- Steroid Hormone Biosynthesis
-