GTSE1 Antikörper (N-Term)

Produktnummer ABIN634069

Produktdetails anti-GTSE1 Antikörper

Target: GTSE1 (G-2 and S-Phase Expressed 1 (GTSE1))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GTSE1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: GTSE1 antibody was raised against the N terminal of GTSE1

Aufreinigung: Affinity purified

Immunogen: GTSE1 antibody was raised using the N terminal of GTSE1 corresponding to a region with amino acids NNPVPEQPPLPTSESPFAWSPLAGEKFVEVYKEAHLLALHIESSSRNQAA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GTSE1 Blocking Peptide, catalog no. 33R-6810, is also available for use as a blocking control in assays to test for specificity of this GTSE1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GTSE1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GTSE1

Target: GTSE1 (G-2 and S-Phase Expressed 1 (GTSE1))

Andere Bezeichnung: GTSE1 (GTSE1 Produkte)

Synonyme: gtse1 antikoerper, MGC81588 antikoerper, MGC89498 antikoerper, GTSE1 antikoerper, fb70b04 antikoerper, fj88g09 antikoerper, wu:fb70b04 antikoerper, wu:fj88g09 antikoerper, wu:fy65d12 antikoerper, MGC114722 antikoerper, B99 antikoerper, Gtse-1 antikoerper, RGD1563164 antikoerper, G2 and S-phase expressed 1 S homeolog antikoerper, G2 and S-phase expressed 1 antikoerper, G-2 and S-phase expressed 1 antikoerper, G2 and S-phase expressed 1 L homeolog antikoerper, G two S phase expressed protein 1 antikoerper, gtse1.S antikoerper, gtse1 antikoerper, GTSE1 antikoerper, gtse1.L antikoerper, Gtse1 antikoerper

Hintergrund: GTSE1 is only expressed in the S and G2 phases of the cell cycle, where it colocalizes with cytoplasmic tubulin and microtubules. In response to DNA damage, the encoded protein accumulates in the nucleus and binds the tumor suppressor protein p53, shuttling it out of the nucleus and repressing its ability to induce apoptosis.

Molekulargewicht: 76 kDa (MW of target protein)