Dynamitin Antikörper
-
- Target Alle Dynamitin (DCTN2) Antikörper anzeigen
- Dynamitin (DCTN2) (Dynactin 2 (p50) (DCTN2))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Dynamitin Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- Dynactin 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids ADPKYADLPGIARNEPDVYETSDLPEDDQAEFDAFAQELEELTSTSVEHI
- Top Product
- Discover our top product DCTN2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Dynactin 2 Blocking Peptide, catalog no. 33R-1100, is also available for use as a blocking control in assays to test for specificity of this Dynactin 2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DCTN2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Dynamitin (DCTN2) (Dynactin 2 (p50) (DCTN2))
- Andere Bezeichnung
- Dynactin 2 (DCTN2 Produkte)
- Synonyme
- DCTN2 antikoerper, dctn2 antikoerper, dctn50 antikoerper, dynamitin antikoerper, rbp50 antikoerper, CG8269 antikoerper, DMN antikoerper, Dmel\\CG8269 antikoerper, P50 antikoerper, dDyn antikoerper, dmn antikoerper, dyna antikoerper, l(2)k16109 antikoerper, l(2)k16218 antikoerper, p50 antikoerper, p50/Dmn antikoerper, p50/dynamitin antikoerper, 2310042E05Rik antikoerper, C130077D06Rik antikoerper, C87049 antikoerper, DCTN-50 antikoerper, GMP23-48K antikoerper, RBP50 antikoerper, DCTN50 antikoerper, DYNAMITIN antikoerper, zgc:63867 antikoerper, dynactin subunit 2 antikoerper, dynactin subunit 2 S homeolog antikoerper, Dynactin 2, p50 subunit antikoerper, dynactin 2 antikoerper, dynactin 2 (p50) antikoerper, dynactin subunit 2 L homeolog antikoerper, DCTN2 antikoerper, dctn2.S antikoerper, DCTN2-p50 antikoerper, dctn2 antikoerper, Dctn2 antikoerper, dctn2.L antikoerper
- Hintergrund
- DCTN2 is a 50 kDa subunit of dynactin, a macromolecular complex consisting of 10-11 subunits ranging in size from 22 to 150 kDa. Dynactin binds to both microtubules and cytoplasmic dynein. It is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, chromosome movement, nuclear positioning, and axonogenesis.
- Molekulargewicht
- 45 kDa (MW of target protein)
- Pathways
- M Phase, Ribonucleoprotein Complex Subunit Organization
-