CDC25B Antikörper

Produktnummer ABIN634076

Produktdetails anti-CDC25B Antikörper

Target: CDC25B (Cell Division Cycle 25 Homolog B (S. Pombe) (CDC25B))

Reaktivität: Human, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CDC25B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Aufreinigung: Affinity purified

Immunogen: CDC25 B antibody was raised using a synthetic peptide corresponding to a region with amino acids TQTMHDLAGLGSETPKSQVGTLLFRSRSRLTHLSLSRRASESSLSSESSE

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CDC25B Blocking Peptide, catalog no. 33R-9253, is also available for use as a blocking control in assays to test for specificity of this CDC25B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDC20 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CDC25B

Target: CDC25B (Cell Division Cycle 25 Homolog B (S. Pombe) (CDC25B))

Andere Bezeichnung: CDC25B (CDC25B Produkte)

Synonyme: CDC25B antikoerper, AI604853 antikoerper, cell division cycle 25B antikoerper, cdc25b antikoerper, CDC25B antikoerper, Cdc25b antikoerper

Hintergrund: CDC25B is a member of the CDC25 family of phosphatases. CDC25B activates the cyclin dependent kinase CDC2 by removing two phosphate groups and it is required for entry into mitosis. CDC25B shuttles between the nucleus and the cytoplasm due to nuclear localization and nuclear export signals. The protein is nuclear in the M and G1 phases of the cell cycle and moves to the cytoplasm during S and G2. CDC25B has oncogenic properties, although its role in tumor formation has not been determined.

Molekulargewicht: 65 kDa (MW of target protein)

Pathways: Zellzyklus, M Phase, Autophagie