RFC3 Antikörper

Produktnummer ABIN634080

Produktdetails anti-RFC3 Antikörper

Target: RFC3 (Replication Factor C (Activator 1) 3, 38kDa (RFC3))

Reaktivität: Human, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RFC3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: RFC3 antibody was raised using a synthetic peptide corresponding to a region with amino acids YHLEVNPSDAGNSDRVVIQEMLKTVAQSQQLETNSQRDFKVVLLTEVDKL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RFC3 Blocking Peptide, catalog no. 33R-10126, is also available for use as a blocking control in assays to test for specificity of this RFC3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RFC3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RFC3

Target: RFC3 (Replication Factor C (Activator 1) 3, 38kDa (RFC3))

Andere Bezeichnung: RFC3 (RFC3 Produkte)

Synonyme: CG5313 antikoerper, DRFC antikoerper, DmRFC3 antikoerper, Dmel\\CG5313 antikoerper, Rfc3 antikoerper, 21.m02902 antikoerper, 2810416I22Rik antikoerper, 38kDa antikoerper, AU022547 antikoerper, Recc3 antikoerper, cb275 antikoerper, RFC38 antikoerper, Replication factor C subunit 3 antikoerper, replication factor C3 antikoerper, replication factor C subunit 3 antikoerper, replication factor C 38 kDa subunit antikoerper, DNA replication factor C complex subunit Rfc3 antikoerper, replication factor C3, putative antikoerper, replication factor C (activator 1) 3 antikoerper, replication factor C subunit 3 L homeolog antikoerper, RfC3 antikoerper, PF14_0601 antikoerper, Chro.30359 antikoerper, PB000006.01.0 antikoerper, PC000345.04.0 antikoerper, TP04_0380 antikoerper, Tb09.211.3310 antikoerper, PY04255 antikoerper, PVX_117300 antikoerper, BBOV_IV003080 antikoerper, SJAG_02182 antikoerper, PKH_124240 antikoerper, rfc3 antikoerper, Rfc3 antikoerper, RFC3 antikoerper, rfc3.L antikoerper

Hintergrund: The elongation of primed DNA templates by DNA polymerase delta and DNA polymerase epsilon requires the accessory proteins proliferating cell nuclear antigen (PCNA) and replication factor C (RFC). RFC, also named activator 1, is a protein complex consisting of five distinct subunits of 140, 40, 38, 37, and 36 kDa. RFC3 is the 38 kDa subunit. This subunit is essential for the interaction between the 140 kDa subunit and the core complex that consists of the 36, 37, and 40 kDa subunits.

Molekulargewicht: 40 kDa (MW of target protein)

Pathways: Telomere Maintenance, DNA Reparatur, DNA Replication, Synthesis of DNA