MCM3 Antikörper (C-Term)
-
- Target Alle MCM3 Antikörper anzeigen
- MCM3 (Minichromosome Maintenance Complex Component 3 (MCM3))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MCM3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- MCM3 antibody was raised against the C terminal of MCM3
- Aufreinigung
- Affinity purified
- Immunogen
- MCM3 antibody was raised using the C terminal of MCM3 corresponding to a region with amino acids YAYFKKVLEKEKKRKKRSEDESETEDEEEKSQEDQEQKRKRRKTRQPDAK
- Top Product
- Discover our top product MCM3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MCM3 Blocking Peptide, catalog no. 33R-10056, is also available for use as a blocking control in assays to test for specificity of this MCM3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MCM3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MCM3 (Minichromosome Maintenance Complex Component 3 (MCM3))
- Andere Bezeichnung
- MCM3 (MCM3 Produkte)
- Synonyme
- HCC5 antikoerper, P1-MCM3 antikoerper, P1.h antikoerper, RLFB antikoerper, AL033361 antikoerper, C80350 antikoerper, Mcmd antikoerper, P1 antikoerper, p1.m antikoerper, cb32 antikoerper, chunp6867 antikoerper, wu:fa26g03 antikoerper, CG4206 antikoerper, DmMCM3 antikoerper, DmMcm3 antikoerper, DmeMCM3 antikoerper, Dmel\\CG4206 antikoerper, MCM3 antikoerper, McM3 antikoerper, Mcp-PCR2 antikoerper, PCR2 antikoerper, dMCM3 antikoerper, xmcm3 antikoerper, minichromosome maintenance complex component 3 antikoerper, MCM3 minichromosome maintenance deficient 3 (S. cerevisiae) antikoerper, Minichromosome maintenance 3 antikoerper, minichromosome maintenance complex component 3 L homeolog antikoerper, MCM complex subunit Mcm3 antikoerper, MCM3 antikoerper, mcm3 antikoerper, Mcm3 antikoerper, mcm3.L antikoerper
- Hintergrund
- MCM3 is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are involved in the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein is a subunit of the protein complex that consists of MCM2-7. It has been shown to interact directly with MCM5/CDC46. This protein also interacts with, and thus is acetlyated by MCM3AP, a chromatin-associated acetyltransferase. The acetylation of this protein inhibits the initiation of DNA replication and cell cycle progression.
- Molekulargewicht
- 91 kDa (MW of target protein)
- Pathways
- DNA Reparatur, Mitotic G1-G1/S Phases, DNA Replication, Chromatin Binding, Synthesis of DNA
-