SMC4 Antikörper (Middle Region)
-
- Target Alle SMC4 Antikörper anzeigen
- SMC4 (Structural Maintenance of Chromosomes 4 (SMC4))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SMC4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SMC4 antibody was raised against the middle region of SMC4
- Aufreinigung
- Affinity purified
- Immunogen
- SMC4 antibody was raised using the middle region of SMC4 corresponding to a region with amino acids EARCHEMKPNLGAIAEYKKKEELYLQRVAELDKITYERDSFRQAYEDLRK
- Top Product
- Discover our top product SMC4 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SMC4 Blocking Peptide, catalog no. 33R-2280, is also available for use as a blocking control in assays to test for specificity of this SMC4 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SMC4 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SMC4 (Structural Maintenance of Chromosomes 4 (SMC4))
- Andere Bezeichnung
- SMC4 (SMC4 Produkte)
- Hintergrund
- SMC4 is the central component of the condensin complex, a complex required for conversion of interphase chromatin into mitotic-like condense chromosomes. The condensin complex probably introduces positive supercoils into relaxed DNA in the presence of type I topoisomerases and converts nicked DNA into positive knotted forms in the presence of type II topoisomerases.
- Molekulargewicht
- 147 kDa (MW of target protein)
-