SMC4 Antikörper (Middle Region)

Produktnummer ABIN634091

Produktdetails anti-SMC4 Antikörper

Target: SMC4 (Structural Maintenance of Chromosomes 4 (SMC4))

Bindungsspezifität: Middle Region

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SMC4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SMC4 antibody was raised against the middle region of SMC4

Aufreinigung: Affinity purified

Immunogen: SMC4 antibody was raised using the middle region of SMC4 corresponding to a region with amino acids EARCHEMKPNLGAIAEYKKKEELYLQRVAELDKITYERDSFRQAYEDLRK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SMC4 Blocking Peptide, catalog no. 33R-2280, is also available for use as a blocking control in assays to test for specificity of this SMC4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SMC4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SMC4

Target: SMC4 (Structural Maintenance of Chromosomes 4 (SMC4))

Andere Bezeichnung: SMC4 (SMC4 Produkte)

Synonyme: CAP-C antikoerper, CAPC antikoerper, SMC-4 antikoerper, SMC4L1 antikoerper, hCAP-C antikoerper, 2500002A22Rik antikoerper, C79747 antikoerper, Smc4l1 antikoerper, cb788 antikoerper, chunp6901 antikoerper, fb99b10 antikoerper, smc4l1 antikoerper, wu:fb99b10 antikoerper, xcap-c antikoerper, ARABIDOPSIS THALIANA CHROMOSOME ASSOCIATED PROTEIN-C antikoerper, ARABIDOPSIS THALIANA STRUCTURAL MAINTENANCE OF CHROMOSOME 4 antikoerper, ATCAP-C antikoerper, ATSMC3 antikoerper, ATSMC4 antikoerper, K15N18.7 antikoerper, K15N18_7 antikoerper, STRUCTURAL MAINTENANCE OF CHROMOSOMES 3 antikoerper, structural maintenance of chromosome 3 antikoerper, Structural maintenance of chromosomes protein 4 antikoerper, structural maintenance of chromosomes 4 antikoerper, structural maintenance of chromosomes 4 L homeolog antikoerper, structural maintenance of chromosome 3 antikoerper, smc-4 antikoerper, SMC4 antikoerper, Smc4 antikoerper, smc4 antikoerper, smc4.L antikoerper, SMC3 antikoerper

Hintergrund: SMC4 is the central component of the condensin complex, a complex required for conversion of interphase chromatin into mitotic-like condense chromosomes. The condensin complex probably introduces positive supercoils into relaxed DNA in the presence of type I topoisomerases and converts nicked DNA into positive knotted forms in the presence of type II topoisomerases.

Molekulargewicht: 147 kDa (MW of target protein)