NCAPH Antikörper (N-Term)

Produktnummer ABIN634092

Produktdetails anti-NCAPH Antikörper

Target: NCAPH (Non-SMC Condensin I Complex, Subunit H (NCAPH))

Bindungsspezifität: N-Term

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NCAPH Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: NCAPH antibody was raised against the N terminal of NCAPH

Aufreinigung: Affinity purified

Immunogen: NCAPH antibody was raised using the N terminal of NCAPH corresponding to a region with amino acids MPLPRKAPLNIPGTPVLEDFPQNDDEKERLQRRRSRVFDLQFSTDSPRLL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NCAPH Blocking Peptide, catalog no. 33R-6292, is also available for use as a blocking control in assays to test for specificity of this NCAPH antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NCAPH antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NCAPH

Target: NCAPH (Non-SMC Condensin I Complex, Subunit H (NCAPH))

Andere Bezeichnung: NCAPH (NCAPH Produkte)

Synonyme: NCAPH antikoerper, si:dkeyp-86b9.4 antikoerper, zgc:158618 antikoerper, BRRN1 antikoerper, CAP-H antikoerper, brrn1 antikoerper, cap-h antikoerper, A730011O11Rik antikoerper, Brrn1 antikoerper, HCAP-H antikoerper, mKIAA0074 antikoerper, non-SMC condensin I complex subunit H antikoerper, non-SMC condensin I complex, subunit H antikoerper, condensin complex subunit 2 antikoerper, non-SMC condensin I complex subunit H S homeolog antikoerper, NCAPH antikoerper, ncaph antikoerper, LOC708975 antikoerper, ncaph.S antikoerper, Ncaph antikoerper

Hintergrund: NCAPH is a member of the barr family and a regulatory subunit of the condensin complex. This complex is required for the conversion of interphase chromatin into condensed chromosomes. The protein is associated with mitotic chromosomes, except during the early phase of chromosome condensation. During interphase, the protein has a distinct punctate nucleolar localization.

Molekulargewicht: 82 kDa (MW of target protein)