HERC5 Antikörper (N-Term)

Produktnummer ABIN634097

Produktdetails anti-HERC5 Antikörper

Target: HERC5 (Hect Domain and RLD 5 (HERC5))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HERC5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: HERC5 antibody was raised against the N terminal of HERC5

Aufreinigung: Affinity purified

Immunogen: HERC5 antibody was raised using the N terminal of HERC5 corresponding to a region with amino acids CLVAELVGYRVTQIACGRWHTLAYVSDLGKVFSFGSGKDGQLGNGGTRDQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HERC5 Blocking Peptide, catalog no. 33R-1749, is also available for use as a blocking control in assays to test for specificity of this HERC5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HERC5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HERC5

Target: HERC5 (Hect Domain and RLD 5 (HERC5))

Andere Bezeichnung: HERC5 (HERC5 Produkte)

Synonyme: HERC5 antikoerper, CEB1 antikoerper, CEBP1 antikoerper, HECT and RLD domain containing E3 ubiquitin protein ligase 5 antikoerper, hect domain and RLD 5 antikoerper, HERC5 antikoerper

Hintergrund: HERC5 is a probable E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates.

Molekulargewicht: 117 kDa (MW of target protein)