RFC5 Antikörper

Produktnummer ABIN634103

Produktdetails anti-RFC5 Antikörper

Target: RFC5 (Replication Factor C (Activator 1) 5, 36.5kDa (RFC5))

Reaktivität: Human, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RFC5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Aufreinigung: Affinity purified

Immunogen: RFC5 antibody was raised using a synthetic peptide corresponding to a region with amino acids METSALKQQEQPAATKIRNLPWVEKYRPQTLNDLISHQDILSTIQKFINE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RFC5 Blocking Peptide, catalog no. 33R-5977, is also available for use as a blocking control in assays to test for specificity of this RFC5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RFC5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RFC5

Target: RFC5 (Replication Factor C (Activator 1) 5, 36.5kDa (RFC5))

Andere Bezeichnung: RFC5 (RFC5 Produkte)

Synonyme: zgc:110313 antikoerper, 2610020K06Rik antikoerper, 2610209F07Rik antikoerper, 36.5kDa antikoerper, 36kDa antikoerper, Recc5 antikoerper, RFC36 antikoerper, replication factor C (activator 1) 5 antikoerper, replication factor C subunit 5 antikoerper, replication factor C subunit 5 L homeolog antikoerper, rfc5 antikoerper, Rfc5 antikoerper, RFC5 antikoerper, rfc5.L antikoerper

Hintergrund: The elongation of primed DNA templates by DNA polymerase delta and DNA polymerase epsilon requires the accessory proteins proliferating cell nuclear antigen (PCNA) and replication factor C (RFC). RFC, also named activator 1, is a protein complex consisting of five distinct subunits of 140, 40, 38, 37, and 36 kDa. RFC5 is the 36 kDa subunit. This subunit can interact with the C-terminal region of PCNA. It forms a core complex with the 38 and 40 kDa subunits. The core complex possesses DNA-dependent ATPase activity, which was found to be stimulated by PCNA in an in vitro system.

Molekulargewicht: 38 kDa (MW of target protein)

Pathways: Telomere Maintenance, DNA Reparatur, DNA Replication, Synthesis of DNA