NPM2 Antikörper (N-Term)

Produktnummer ABIN634104

Produktdetails anti-NPM2 Antikörper

Target: NPM2 (Nucleophosmin/nucleoplasmin 2 (NPM2))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NPM2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: NPM2 antibody was raised against the N terminal of NPM2

Aufreinigung: Affinity purified

Immunogen: NPM2 antibody was raised using the N terminal of NPM2 corresponding to a region with amino acids LEGKQSCRLLLHTICLGEKAKEEMHRVEILPPANQEDKKMQPVTIASLQA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NPM2 Blocking Peptide, catalog no. 33R-4898, is also available for use as a blocking control in assays to test for specificity of this NPM2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NPM2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NPM2

Target: NPM2 (Nucleophosmin/nucleoplasmin 2 (NPM2))

Andere Bezeichnung: NPM2 (NPM2 Produkte)

Synonyme: nucleophosmin/nucleoplasmin 2 antikoerper, Npm2 antikoerper, NPM2 antikoerper

Hintergrund: NPM2 belongs to the nucleoplasmin family. It probably involved in sperm DNA decondensation during fertilization.

Molekulargewicht: 24 kDa (MW of target protein)