KIF2A Antikörper (C-Term)
-
- Target Alle KIF2A Antikörper anzeigen
- KIF2A (Kinesin Heavy Chain Member 2A (KIF2A))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser KIF2A Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- KIF2 A antibody was raised against the C terminal of KIF2
- Aufreinigung
- Affinity purified
- Immunogen
- KIF2 A antibody was raised using the C terminal of KIF2 corresponding to a region with amino acids ETQWGVGSSPQRDDLKLLCEQNEEEVSPQLFTFHEAVSQMVEMEEQVVED
- Top Product
- Discover our top product KIF2A Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
KIF2A Blocking Peptide, catalog no. 33R-2768, is also available for use as a blocking control in assays to test for specificity of this KIF2A antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIF0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KIF2A (Kinesin Heavy Chain Member 2A (KIF2A))
- Andere Bezeichnung
- KIF2A (KIF2A Produkte)
- Hintergrund
- KIF2A belongs to the kinesin-like protein family, MCAK/KIF2 subfamily. It contains 1 kinesin-motor domain. KIF2A plus end-directed microtubule-dependent motor required for normal brain development. It may regulate microtubule dynamics during axonal growth. KIF2A is implicated in formation of bipolar mitotic spindles. It has microtubule depolymerization activity. Hela cells lacking KIF2A show asymmetric or monopolar mitotic spindles. Osteosarcoma cells (U2OS) lacking KIF2A or KIF2B show disorganised or monopolar mitotic spindles.
- Molekulargewicht
- 80 kDa (MW of target protein)
- Pathways
- Microtubule Dynamics, Ribonucleoprotein Complex Subunit Organization
-