KIF1A Antikörper (N-Term)
-
- Target Alle KIF1A Antikörper anzeigen
- KIF1A (Kinesin Family Member 1A (KIF1A))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Maus, Human, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser KIF1A Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- KIF1 A antibody was raised against the N terminal of KIF1
- Aufreinigung
- Affinity purified
- Immunogen
- KIF1 A antibody was raised using the N terminal of KIF1 corresponding to a region with amino acids TTIVNPKQPKETPKSFSFDYSYWSHTSPEDINYASQKQVYRDIGEEMLQH
- Top Product
- Discover our top product KIF1A Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
KIF1A Blocking Peptide, catalog no. 33R-9321, is also available for use as a blocking control in assays to test for specificity of this KIF1A antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIF0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KIF1A (Kinesin Family Member 1A (KIF1A))
- Andere Bezeichnung
- KIF1A (KIF1A Produkte)
- Hintergrund
- The protein encoded by this gene is a member of the kinesin family. This protein is highly similar to mouse heavy chain kinesin member 1A protein which is an anterograde motor protein that transports membranous organelles along axonal microtubules. It is thought that this protein may play a critical role in the development of axonal neuropathies resulting from impaired axonal transport.
- Molekulargewicht
- 191 kDa (MW of target protein)
-