KIF1A Antikörper (N-Term)

Produktnummer ABIN634107

Produktdetails anti-KIF1A Antikörper

Target: KIF1A (Kinesin Family Member 1A (KIF1A))

Bindungsspezifität: N-Term

Reaktivität: Maus, Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KIF1A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: KIF1 A antibody was raised against the N terminal of KIF1

Aufreinigung: Affinity purified

Immunogen: KIF1 A antibody was raised using the N terminal of KIF1 corresponding to a region with amino acids TTIVNPKQPKETPKSFSFDYSYWSHTSPEDINYASQKQVYRDIGEEMLQH

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KIF1A Blocking Peptide, catalog no. 33R-9321, is also available for use as a blocking control in assays to test for specificity of this KIF1A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIF0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KIF1A

Target: KIF1A (Kinesin Family Member 1A (KIF1A))

Andere Bezeichnung: KIF1A (KIF1A Produkte)

Synonyme: ATSV antikoerper, C630002N23Rik antikoerper, Gm1626 antikoerper, Kns1 antikoerper, C2orf20 antikoerper, HSN2C antikoerper, MRD9 antikoerper, SPG30 antikoerper, UNC104 antikoerper, kinesin family member 1A antikoerper, kinesin family member 1Aa antikoerper, KIF1A antikoerper, kif1a antikoerper, Kif1a antikoerper, kif1aa antikoerper

Hintergrund: The protein encoded by this gene is a member of the kinesin family. This protein is highly similar to mouse heavy chain kinesin member 1A protein which is an anterograde motor protein that transports membranous organelles along axonal microtubules. It is thought that this protein may play a critical role in the development of axonal neuropathies resulting from impaired axonal transport.

Molekulargewicht: 191 kDa (MW of target protein)