HECA Antikörper
-
- Target Alle HECA Antikörper anzeigen
- HECA (Headcase Homolog (HECA))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser HECA Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- HECA antibody was raised using a synthetic peptide corresponding to a region with amino acids HKLNTFHVRMEDDAQVGQGEDLRKFILAALSASHRNVVNCALCHRALPVF
- Top Product
- Discover our top product HECA Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
HECA Blocking Peptide, catalog no. 33R-3766, is also available for use as a blocking control in assays to test for specificity of this HECA antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HECA antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HECA (Headcase Homolog (HECA))
- Andere Bezeichnung
- HECA (HECA Produkte)
- Synonyme
- HECA antikoerper, si:dkey-34f16.2 antikoerper, HDC antikoerper, HDCL antikoerper, HHDC antikoerper, dJ225E12.1 antikoerper, Gm869 antikoerper, hdc homolog, cell cycle regulator antikoerper, Heca antikoerper, HECA antikoerper, heca antikoerper
- Hintergrund
- This gene encodes the homolog of the Drosophila headcase protein, a highly basic, cytoplasmic protein that regulates the re-entry of imaginal cells into the mitotic cycle during adult morphogenesis.
- Molekulargewicht
- 59 kDa (MW of target protein)
-