CDT1 Antikörper (C-Term)
-
- Target Alle CDT1 Antikörper anzeigen
- CDT1 (Chromatin Licensing and DNA Replication Factor 1 (CDT1))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CDT1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- CDT1 antibody was raised against the C terminal of CDT1
- Aufreinigung
- Affinity purified
- Immunogen
- CDT1 antibody was raised using the C terminal of CDT1 corresponding to a region with amino acids PATPPATPPAASPSALKGVSQDLLERIRAKEAQKQLAQMTRCPEQEQRLQ
- Top Product
- Discover our top product CDT1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CDT1 Blocking Peptide, catalog no. 33R-6985, is also available for use as a blocking control in assays to test for specificity of this CDT1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDT1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CDT1 (Chromatin Licensing and DNA Replication Factor 1 (CDT1))
- Andere Bezeichnung
- CDT1 (CDT1 Produkte)
- Hintergrund
- CDT1 cooperates with CDC6 to promote the loading of the mini-chromosome maintenance complex onto chromatin to form the pre-replication complex necessary to initiate DNA replication.
- Molekulargewicht
- 60 kDa (MW of target protein)
- Pathways
- MAPK Signalweg, Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA
-