CDT1 Antikörper (C-Term)

Produktnummer ABIN634110

Produktdetails anti-CDT1 Antikörper

Target: CDT1 (Chromatin Licensing and DNA Replication Factor 1 (CDT1))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CDT1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CDT1 antibody was raised against the C terminal of CDT1

Aufreinigung: Affinity purified

Immunogen: CDT1 antibody was raised using the C terminal of CDT1 corresponding to a region with amino acids PATPPATPPAASPSALKGVSQDLLERIRAKEAQKQLAQMTRCPEQEQRLQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CDT1 Blocking Peptide, catalog no. 33R-6985, is also available for use as a blocking control in assays to test for specificity of this CDT1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDT1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CDT1

Target: CDT1 (Chromatin Licensing and DNA Replication Factor 1 (CDT1))

Andere Bezeichnung: CDT1 (CDT1 Produkte)

Synonyme: CDT1 antikoerper, fc37h07 antikoerper, im:7158083 antikoerper, wu:fc37h07 antikoerper, wu:fi38h09 antikoerper, xcdt1 antikoerper, DUP antikoerper, RIS2 antikoerper, 2610318F11Rik antikoerper, AW545653 antikoerper, C76791 antikoerper, Ris2 antikoerper, dup antikoerper, ris2 antikoerper, chromatin licensing and DNA replication factor 1 antikoerper, chromatin licensing and DNA replication factor 1 L homeolog antikoerper, CDT1 antikoerper, cdt1 antikoerper, Cdt1 antikoerper, cdt1.L antikoerper

Hintergrund: CDT1 cooperates with CDC6 to promote the loading of the mini-chromosome maintenance complex onto chromatin to form the pre-replication complex necessary to initiate DNA replication.

Molekulargewicht: 60 kDa (MW of target protein)

Pathways: MAPK Signalweg, Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA