Septin 12 Antikörper (Middle Region)
-
- Target Alle Septin 12 (Sep12) Antikörper anzeigen
- Septin 12 (Sep12)
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Septin 12 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Septin 12 antibody was raised against the middle region of 40433
- Aufreinigung
- Affinity purified
- Immunogen
- Septin 12 antibody was raised using the middle region of 40433 corresponding to a region with amino acids LQRLCRTVNVVPVIARADSLTMEEREAFRRRIQQNLRTHCIDVYPQMCFD
- Top Product
- Discover our top product Sep12 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Septin 12 Blocking Peptide, catalog no. 33R-5333, is also available for use as a blocking control in assays to test for specificity of this Septin 12 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of 41153 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Septin 12 (Sep12)
- Andere Bezeichnung
- Septin 12 (Sep12 Produkte)
- Hintergrund
- Septins, such as SEPT12, are conserved GTP-binding proteins that function as dynamic, regulatable scaffolds for the recruitment of other proteins. They are involved in membrane dynamics, vesicle trafficking, apoptosis, and cytoskeleton remodeling, as well as infection, neurodegeneration, and neoplasia.Septins, such as SEPT12, are conserved GTP-binding proteins that function as dynamic, regulatable scaffolds for the recruitment of other proteins.
- Molekulargewicht
- 41 kDa (MW of target protein)
-