Septin 12 Antikörper (Middle Region)

Produktnummer ABIN634113

Produktdetails anti-Septin 12 Antikörper

Target: Septin 12 (Sep12)

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Septin 12 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Septin 12 antibody was raised against the middle region of 40433

Aufreinigung: Affinity purified

Immunogen: Septin 12 antibody was raised using the middle region of 40433 corresponding to a region with amino acids LQRLCRTVNVVPVIARADSLTMEEREAFRRRIQQNLRTHCIDVYPQMCFD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Septin 12 Blocking Peptide, catalog no. 33R-5333, is also available for use as a blocking control in assays to test for specificity of this Septin 12 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of 41153 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Septin 12

Target: Septin 12 (Sep12)

Andere Bezeichnung: Septin 12 (Sep12 Produkte)

Synonyme: MGC68931 antikoerper, fe23c11 antikoerper, si:dkey-23a11.2 antikoerper, wu:fe23c11 antikoerper, SPGF10 antikoerper, 1700028G04Rik antikoerper, 4933413B09Rik antikoerper, Septin12 antikoerper, septin 12 S homeolog antikoerper, septin 12 antikoerper, sept12.S antikoerper, SEPT12 antikoerper, sept12 antikoerper, Sept12 antikoerper

Hintergrund: Septins, such as SEPT12, are conserved GTP-binding proteins that function as dynamic, regulatable scaffolds for the recruitment of other proteins. They are involved in membrane dynamics, vesicle trafficking, apoptosis, and cytoskeleton remodeling, as well as infection, neurodegeneration, and neoplasia.Septins, such as SEPT12, are conserved GTP-binding proteins that function as dynamic, regulatable scaffolds for the recruitment of other proteins.

Molekulargewicht: 41 kDa (MW of target protein)