KIF23 Antikörper (N-Term)

Produktnummer ABIN634117

Produktdetails anti-KIF23 Antikörper

Target: KIF23 (Kinesin Family Member 23 (KIF23))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KIF23 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: KIF23 antibody was raised against the N terminal of KIF23

Aufreinigung: Affinity purified

Immunogen: KIF23 antibody was raised using the N terminal of KIF23 corresponding to a region with amino acids VRPLGFPDQECCIEVINNTTVQLHTPEGYRLNRNGDYKETQYSFKQVFGT

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KIF23 Blocking Peptide, catalog no. 33R-9781, is also available for use as a blocking control in assays to test for specificity of this KIF23 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIF23 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KIF23

Target: KIF23 (Kinesin Family Member 23 (KIF23))

Andere Bezeichnung: KIF23 (KIF23 Produkte)

Synonyme: KIF23 antikoerper, CHO1 antikoerper, KNSL5 antikoerper, MKLP-1 antikoerper, MKLP1 antikoerper, 3110001D19Rik antikoerper, C87313 antikoerper, Knsl5 antikoerper, cb738 antikoerper, knsl5 antikoerper, mklp1 antikoerper, wu:fi30e02 antikoerper, wu:fi39f08 antikoerper, zMKLP1 antikoerper, cho1 antikoerper, mklp-1 antikoerper, kinesin family member 23 antikoerper, kinesin family member 23 S homeolog antikoerper, KIF23 antikoerper, kif23 antikoerper, Kif23 antikoerper, kif23.S antikoerper

Hintergrund: KIF23 is a member of kinesin-like protein family. This family includes microtubule-dependent molecular motors that transport organelles within cells and move chromosomes during cell division. This protein has been shown to cross-bridge antiparallel microtubules and drive microtubule movement in vitro. Alternate splicing of this gene results in two transcript variants encoding two different isoforms.

Molekulargewicht: 98 kDa (MW of target protein)