MCM9 Antikörper (N-Term)
-
- Target Alle MCM9 Antikörper anzeigen
- MCM9 (Minichromosome Maintenance Deficient 9 (MCM9))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MCM9 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- MCM9 antibody was raised against the N terminal of MCM9
- Aufreinigung
- Affinity purified
- Immunogen
- MCM9 antibody was raised using the N terminal of MCM9 corresponding to a region with amino acids NSDQVTLVGQVFESYVSEYHKNDILLILKERDEDAHYPVVVNAMTLFETN
- Top Product
- Discover our top product MCM9 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MCM9 Blocking Peptide, catalog no. 33R-6870, is also available for use as a blocking control in assays to test for specificity of this MCM9 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MCM9 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MCM9 (Minichromosome Maintenance Deficient 9 (MCM9))
- Andere Bezeichnung
- MCM9 (MCM9 Produkte)
- Hintergrund
- MCM9 is a protein that shares similarity with minichromosome maintenance (MCM) proteins, which are known to be essential for initiation of DNA replication.
- Molekulargewicht
- 44 kDa (MW of target protein)
-